Categorygithub.com/openshift-online/ocm-cli
repository
1.0.8
Repository: https://github.com/openshift-online/ocm-cli.git
Documentation: pkg.go.dev

# Packages

No description provided by the author
No description provided by the author
No description provided by the author

# README

OCM API Command Line Tools

This project contains the ocm command line tool that simplifies the use of the OCM API available at https://api.openshift.com.

Installation

Linux Package Manager

The preferred way to install the tool in Fedora and CentOS is to use the RPM packages built in Fedora Copr. To enable that repository and install the tool use the following commands:

# dnf copr enable ocm/tools
# dnf install ocm-cli

This will install the ocm command and will keep it updated using the same mechanism used to update all the other packages of the distribution.

MacOS Brew

$ brew install ocm

Build From Source

If you are not using one of these distributions or you don't want to use the RPM packages then you can alternatively get the release binaries from the GitHub releases page. For example, to install version 0.1.30 to your personal bin directory you can use the following commands:

$ mkdir -p ~/bin
$ curl -Lo ~/bin/ocm https://github.com/openshift-online/ocm-cli/releases/download/v0.1.30/ocm-linux-amd64
$ chmod +x ~/bin/ocm

Finally, if none of the installation options described above work for you then you can install it using go get or go install:

$ go get -u github.com/openshift-online/ocm-cli/cmd/ocm

or

$ go install github.com/openshift-online/ocm-cli/cmd/ocm@latest

But take into account that the results of installing with go get depend on the version of Go that you use and on the values of certain environment variables. It is particularly problematic to install with go get if the version of Go used doesn't support modules, because the dependencies used may not be the ones tested by the developers. In general installations done with go get aren't supported or recommended.

Activating shell completions

Run the following to see instructions for various shells:

$ ocm completion --help

Log In

The first step to use the tool is to log-in with your OpenShift Cluster Manager offline access token which you can get below:

https://console.redhat.com/openshift/token

To do that use the login command:

$ ocm login --token=eyJ...

This will use the provided token to request OpenID access and refresh tokens to sso.redhat.com. The tokens will be saved for future use to the ~/.config/ocm/ocm.json file.

Note: MacOS store the token at ~/Library/Application\ Support/ocm/ocm.json

IMPORTANT: Before version 0.1.56 the configuration file used to be ~/.ocm.json. If that exists it will still be used. It is recommended to remove it and login again, or move it to the new location. For example:

$ mkdir -p ~/.config/ocm
$ mv ~/.ocm.json ~/.config/ocm/ocm.json

The login command has options to log-in to other environments. For example, if you have a service running in your local environment and you want to use the tool to test it, you can log-in like this:

$ ocm login \
--token=eyJ... \
--url=https://localhost:8000 \
--insecure

NOTE: The insecure option disables verification of TLS certificates and host names, do not use it in production environments.

Multiple Concurrent Logins with OCM_CONFIG

An ~/config/ocm/ocm.json file stores login credentials for a single API server. Using multiple servers therefore requires having to log in and out a lot or the ability to utilize multiple config files. The latter functionality is provided with the OCM_CONFIG environment variable. If running ocm login was successful in both cases, the ocm whoami commands will return different results:

$ OCM_CONFIG=$HOME/ocm.json.prod ocm login --url=production --token=...
(…)
$ OCM_CONFIG=$HOME/ocm.json.stg ocm login --url=staging --token=...
(…)
$ OCM_CONFIG=$HOME/ocm.json.prod ocm whoami
(…)
$ OCM_CONFIG=$HOME/ocm.json.stg ocm whoami
(…)

NOTE: Tokens for production and staging will differ.

Storing Configuration & Tokens in OS Keyring

The OCM_KEYRING environment variable provides the ability to store the OCM configuration containing your tokens in your OS keyring. This is provided as an alternative to storing the configuration in plain-text on your system. OCM_KEYRING will override OCM_CONFIG if both are set.

OCM_KEYRING supports the following keyrings:

wincredkeychainsecret-servicepass
Windows:heavy_check_mark::x::x::x:
macOS:x::heavy_check_mark:*:x::heavy_check_mark:
Linux:x::x::heavy_check_mark::heavy_check_mark:

Obtaining Tokens

If you need the OpenID access token to use it with some other tool, you can use the token command:

$ ocm token

That will print the raw OpenID access token, which you can then use to send requests to the server with some other tool. For example, if you want to use curl to retrieve your list of clusters you can do the following:

$ curl \
--header "Authorization: Bearer $(ocm token)" \
https://api.openshift.com/api/clusters_mgmt/v1/clusters

The details of the OpenID access token, in JSON format, can be displayed using the --payload option:

$ ocm token --payload

That will display the JSON representation of the access token, which is useful to diagnose authentication issues.

Revoking Tokens

If you've compromised your offline token, you can get it revoked like this:

  1. Make sure you're logged into OCM with your browser.
  2. Go here.
  3. Click REVOKE GRANT for the application cloud-services.

If you now follow the log in procedure new tokens will be generated.

Log Out

To log out run the logout command:

$ ocm logout

That will remove the ~/.config/ocm/ocm.json file, so next time you want to use the tool you will need to log-in again. You can also remove that file manually; the effect is exactly the same.

Retrieving Objects

Once logged in you can use the get command to retrieve objects. For example, to retrieve the list of clusters with a name that starts with my you can use the following command:

$ ocm get /api/clusters_mgmt/v1/clusters --parameter search="name like 'my%'"

The --parameter option is used to specify query parameters. It is most useful combined with the get command, but it can be also used with any other command. For detailed information about the query parameters supported by each resource see the reference documentation.

The search query parameter is specially useful to retrieve objects from collections that support searching. The syntax of this parameter is similar to the syntax of the where clause of an SQL statement, but using the names of the attributes of the object instead of the names of the columns of a table. For example, in order to retrieve the clusters with a name starting with my and created in a DNS domain ending with example.com the complete command can be the following:

$ ocm get /api/clusters_mgmt/v1/clusters \
--parameter search="name like 'my%' and dns.base_domain like '%.example.com'"

To find the AWS regions in the US:

$ ocm get /api/clusters_mgmt/v1/cloud_providers/aws/regions \
--parameter search="display_name like 'US %'"

To find the clusters created after March 1st 2019:

$ ocm get /api/clusters_mgmt/v1/clusters \
--parameter search="creation_timestamp >= '2019-03-01'"

To find the clusters that are either ready or installing:

$ ocm get /api/clusters_mgmt/v1/clusters \
--parameter search="state in ('ready', 'installing')"

The result of that will be a JSON document containing the description of those clusters, for example:

{
  "kind": "ClusterList",
  "page": 1,
  "size": 6,
  "total": 10
  "items": [
    {
      "kind": "Cluster",
      "id": "1GUAUWE3E1IS87Q99M0kxO1LpCG",
      "href": "/api/clusters_mgmt/v1/clusters/1GUAUWE3E1IS87Q99M0kxO1LpCG",
      "name": "mycluster",
      "api": {
        "url": "https://mycluster-api.example.com:6443"
      },
      "console": {
        "url": "https://console-openshift-console.apps.mycluster.example.com"
      },
      ...
    },
    ...
  ]
}

As the server will always return JSON documents it is very convenient to use the jq tool to extract the information that you need. For example, if you want to get the list of identifiers of your clusters you can do the following:

$ ocm get /api/clusters_mgmt/v1/clusters | jq -r .items[].id

That will return something like this:

1FtmglZGw2byDzO8tb2cCtWxCNf
1FtRj13Fz2DIcm4zaDrcLvKAIyf
...

The get command can also be used to retrieve information from sub-resources associated to objects. For example, the credentials of a cluster (SSH keys, administrator password and kubeconfig) are available in a credentials sub-resource. So if your cluster identifier is 123 you can retrieve the credentials with this command:

$ ocm get /api/clusters_mgmt/v1/clusters/123/credentials

Again the jq tool is very useful here. For example, it can be used to extract the kubeconfig to a file that can then be used directly with the oc command:

$ # Get the file:
$ ocm get /api/clusters_mgmt/v1/clusters/123/credentials \
| jq -r .kubeconfig > mycluster.config

$ # Use it:
$ oc --config=mycluster.config get pods

For a complete definition of the types of objects, and their attributes, see the reference documentation.

Creating Objects

To create objects use the post command, and put the JSON representation of the object either in the standard input or else in a file indicated by the --body option. For example, to create a new managed cluster prepare a mycluster.json file with this content:

{
  "name": "mycluster",
  "flavour": {
    "id": "osd-4"
  },
  "region": {
    "id": "us-east-1"
  },
  "managed": true
}

And then use the post command:

$ ocm post /api/clusters_mgmt/v1/clusters < mycluster.json

Or with the --body option:

$ ocm post /api/clusters_mgmt/v1/clusters --body=mycluster.json

That will send the request to the server, which will initiate the process of creating the object, and will return a JSON document containing the representation.

Complicated objects, like a cluster, are usually created asynchronously, so the fact that the server returns a response doesn't mean that the object is ready to use. Clusters, for example, have a state attribute to indicate that. So after creating a cluster you will have to periodically check till the cluster is ready. To do so first get the id returned by the post command:

$ ocm post /api/clusters_mgmt/v1/clusters --body=mycluster.json | jq -r .id

Then use that identifier to check the value of the state attribute, till it is ready:

$ ocm get /api/clusters_mgmt/v1/clusters/123 | jq -r .state

Deleting Objects

Objects can be deleted using the delete command. For example to delete the cluster with identifier 123 use the following command:

$ ocm delete /api/clusters_mgmt/v1/clusters/123

Some objects can be deleted in different ways. For example, a cluster can be deleted completely, destroying all the virtual machines, disks and any other resources it uses. But it can also just be deleted from the database while preserving the virtual machines, disks, etc. To do so the server accepts a deprovision parameter, which can be true or false. To use it with the tool add the --parameter option. For example, to delete the cluster with identifier 123 only from the database, use the following command:

$ ocm delete /api/clusters_mgmt/v1/clusters/123 --parameter "deprovision=false"

Deletion, like creation, is a lengthy process for complicated objects like clusters, and it happens asynchronously. After the delete command finishes it will take some time to actually delete the cluster. That can be checking using the get command till it returns a 404 Not Found response.

Config

The configuration variables can be read and set via the get and set commands. These settings will be persisted in the ~/.config/ocm/ocm.json file in your home directory.

$ ocm config get url
$ ocm config set url https://api.openshift.com

Building RPMs

Currently RPMs are built for Fedora and CentOS using Fedora Copr.

The mechanism selected to do the build is a the following custom script that generates the RPM .spec file:

# Check that the event payload exists:
if [[ ! -f hook_payload ]]; then
    echo "Event payload file 'hook_payload' doesn't exist"
    exit 1
fi

# Check that the event is the creation of a tag:
ref_type=$(cat hook_payload | jq -r .ref_type)
if [[ "${ref_type}" != "tag" ]]; then
    echo "Expected reference type 'tag' but got '${ref_type}'"
    exit 1
fi

# Check that the tag is well formed:
ref=$(cat hook_payload | jq -r .ref)
if [[ ! "${ref}" =~ ^v[0-9]+\.[0-9]+\.[0-9]+$ ]]; then
    echo "Reference '${ref}' isn't well formed"
    exit 1
fi

# Set the version to use:
version="${ref:1}"

# Set the date:
date=$(date +'%a %b %d %Y')

# Generate the .spec file:
cat > ocm-cli.spec.in <<"."
%global debug_package %{nil}

Name: ocm-cli
Version: @version@
Release: 1%{?dist}
Summary: CLI for the Red Hat OpenShift Cluster Manager
License: ASL 2.0
URL: https://github.com/openshift-online/ocm-cli
Source: https://github.com/openshift-online/ocm-cli/archive/v@[email protected]

# We need to download Go explicitly because in most of the platforms that we
# use the version available is too old.
%define go_tar https://go.dev/dl/go1.20.4.linux-amd64.tar.gz
%define go_sum 698ef3243972a51ddb4028e4a1ac63dc6d60821bf18e59a807e051fee0a385bd

BuildRequires: curl
BuildRequires: git
BuildRequires: make

%description
CLI for the Red Hat OpenShift Cluster Manager

%prep
%setup

%build

# Create the Go directories:
export GOROOT="${PWD}/.goroot"
export GOPATH="${PWD}/.gopath"
mkdir "${GOROOT}" "${GOPATH}"
PATH="${GOROOT}/bin:${PATH}"

# Download and install Go:
curl --location --output go.tar.gz %{go_tar}
echo %{go_sum} go.tar.gz | sha256sum --check
tar --directory "${GOROOT}" --extract --strip-components 1 --file go.tar.gz

# Build the binary:
make

%install
install -m 0755 -d %{buildroot}%{_bindir}
install -m 0755 ocm %{buildroot}%{_bindir}

%clean
# This is necessary because Go writes its cache files and directories without
# write permission, and that means that a rgular `rm` can't remove them.
find .gopath -exec chmod +w {} \;
rm -rf .gopath

%files
%license LICENSE.txt
%doc README.md
%doc CHANGES.md
%{_bindir}/*

%changelog
* @date@ OCM <[email protected]> - @version@
- Automatic build for version @version@.
.
sed \
  -e "s/@version@/${version}/g" \
  -e "s/@date@/${date}/g" \
  < ocm-cli.spec.in \
  > ocm-cli.spec

# Bye:
exit 0

If this script needs to be changed you will need to go to the copr user interface and update it manually.

The GitHub repository is configured with a webhook that will trigger the copr build when a new tag is pushed to the repository. If you need to trigger the build manually you can get the URL of that webhook from the copr page and then do something like this:

curl \
--request POST \
--header "Content-Type: application/json" \
--header "Accept: application/json" \
--data '{
  "ref_type": "tag",
  "ref": "v0.1.66"
}' \
--url "https://copr.fedorainfracloud.org/webhooks/custom/.../ocm-cli/"

The build dependencies section of the copr configuration should include the jq package is it is needed to extract the version number from the payload of the event sent by the GitHub webhook.

Extend ocm with plugins

Just like how kubectl plugins works, you can write your own ocm plugins and put the binary under the $PATH directory, the plugin name should be named with prefix ocm-, like ocm-foo.